PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G0886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 205aa    MW: 23651.7 Da    PI: 8.7933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G0886genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.64e-201764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l++++ ++G+++Wk+Ia++ g++R++k+c++rw +yl
      Gh_D06G0886 17 RGAWTAEEDQKLAQVIDLHGPKRWKSIAAKAGLKRSGKSCRLRWMNYL 64
                     89********************************************97 PP

2Myb_DNA-binding51.62.1e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+ + +E++l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l
      Gh_D06G0886  70 KGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNQIKNYWNSHL 115
                      68889*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.8061268IPR017930Myb domain
SuperFamilySSF466899.36E-3015111IPR009057Homeodomain-like
SMARTSM007171.1E-161666IPR001005SANT/Myb domain
PfamPF002493.2E-191764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-251871IPR009057Homeodomain-like
CDDcd001673.39E-121964No hitNo description
SMARTSM007177.2E-1669117IPR001005SANT/Myb domain
PROSITE profilePS5129422.01669119IPR017930Myb domain
PfamPF002496.4E-1570115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2672119IPR009057Homeodomain-like
CDDcd001671.60E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAMAPVTTKC NLKEVNRGAW TAEEDQKLAQ VIDLHGPKRW KSIAAKAGLK RSGKSCRLRW  60
MNYLRPNIKK GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNQIKNY WNSHLSKKIK  120
LNENRNKGSE IQEPVLDNSK GNETVFLPKG SEEGTSKRDD DYNSTPCLFG DTMSDFHSAE  180
ALNWEWMSQF FEINESWDYF AYDII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-311411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1155112e-52AY115511.1 Gossypioides kirkii myb-like transcription factor 3 (MYB3) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452837.11e-151PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI04e-52WER_ARATH; Transcription factor WER
TrEMBLA0A0D2R5531e-151A0A0D2R553_G
STRINGPOPTR_0006s23780.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-53myb domain protein 66